PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe2G103600.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 298aa    MW: 33891.1 Da    PI: 9.0068
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe2G103600.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.41.6e-082266244
                       SSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
    Myb_DNA-binding  2 grWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                        +WT++E +l+ +a + + ++   +W ++a++++ g+t  ++ + +
  Aqcoe2G103600.3.p 22 SKWTQQENKLFENALAIYDKDmpdRWQKVANMIP-GKTVMDVFNQY 66
                       58********************************.***98887776 PP

2Myb_DNA-binding45.61.6e-14128172347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +WT+eE++l++ + k++G+g+W+ I+r++  +Rt+ q+ s+ qky
  Aqcoe2G103600.3.p 128 PWTEEEHKLFLLGLKKYGKGDWRNISRKFVITRTPTQVASHAQKY 172
                        8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.8411971IPR017884SANT domain
SMARTSM007172.0E-92072IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-42069IPR009057Homeodomain-like
SuperFamilySSF466891.09E-122277IPR009057Homeodomain-like
PfamPF002495.1E-72267IPR001005SANT/Myb domain
CDDcd001675.18E-82369No hitNo description
Gene3DG3DSA:1.10.10.602.4E-12119175IPR009057Homeodomain-like
PROSITE profilePS5129421.136121177IPR017930Myb domain
SuperFamilySSF466898.61E-17123177IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-17124176IPR006447Myb domain, plants
SMARTSM007174.5E-13125175IPR001005SANT/Myb domain
PfamPF002497.6E-13128172IPR001005SANT/Myb domain
CDDcd001675.83E-11128173No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MKWGMEILAP YSNWILEDSK SSKWTQQENK LFENALAIYD KDMPDRWQKV ANMIPGKTVM  60
DVFNQYKELE NDVSDIEAGL IPLPGYTTSS FSLEWMNEHD DYDGLKQSCG PGIKRTRPSD  120
HERKKGVPWT EEEHKLFLLG LKKYGKGDWR NISRKFVITR TPTQVASHAQ KYFIRQHSGG  180
KDKRRSSIHD ITTVNCIEGS PLPDNNNPSS PDHSMLSQQP TGGYPAKTHF GWNQPHNRGN  240
MIFRSKHGDL ITPPTYGITS NEMKLQGHNL QGVTIHGSQV IPQRTAIQMH SSQCHPH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A5e-1524891176RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002525595.11e-131PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-112DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLB9SHX61e-131B9SHX6_RICCO; DNA binding protein, putative
STRINGVIT_06s0004g06100.t011e-127(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.13e-82MYB family protein